CXCL5_HUMAN   P42830


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P42830

Recommended name:C-X-C motif chemokine 5

EC number:

Alternative names:(ENA-78(1-78)) (Epithelial-derived neutrophil-activating protein 78) (Neutrophil-activating peptide ENA-78) (Small-inducible cytokine B5)

Cleaved into:ENA-78(8-78); ENA-78(9-78)

GeneID:6374

Gene names  (primary ):CXCL5

Gene names  (synonym ):ENA78 SCYB5

Gene names  (ORF ):

Length:114

Mass:11972

Sequence:MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN

Tissue specificity:

Induction:

Developmental stage:

Protein families:Intercrine alpha (chemokine CxC) family


   💬 WhatsApp