DIRA1_HUMAN O95057
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O95057
Recommended name：GTP-binding protein Di-Ras1
EC number：
Alternative names：(Distinct subgroup of the Ras family member 1) (Ras-related inhibitor of cell growth) (Rig) (Small GTP-binding tumor suppressor 1)
Cleaved into：
GeneID：148252
Gene names (primary )：DIRAS1
Gene names (synonym )：GBTS1 RIG
Gene names (ORF )：
Length：198
Mass：22329
Sequence：MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKCTLM
Tissue specificity：Highly expressed in heart and brain. {ECO:0000269|PubMed:12107278, ECO:0000269|PubMed:12194967}.
Induction：
Developmental stage：
Protein families：Small GTPase superfamily, Di-Ras family