CX6B1_HUMAN P14854
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P14854
Recommended name：Cytochrome c oxidase subunit 6B1
EC number：
Alternative names：(Cytochrome c oxidase subunit VIb isoform 1) (COX VIb-1)
Cleaved into：
GeneID：1340
Gene names (primary )：COX6B1
Gene names (synonym )：COX6B
Gene names (ORF )：
Length：86
Mass：10192
Sequence：MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI
Tissue specificity：
Induction：
Developmental stage：
Protein families：Cytochrome c oxidase subunit 6B family