CRIS3_HUMAN   P54108


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P54108

Recommended name:Cysteine-rich secretory protein 3

EC number:

Alternative names:(CRISP-3) (Specific granule protein of 28 kDa) (SGP28)

Cleaved into:

GeneID:10321

Gene names  (primary ):CRISP3

Gene names  (synonym ):

Gene names  (ORF ):

Length:245

Mass:27630

Sequence:MTLFPVLLFLVAGLLPSFPANEDKDPAFTALLTTQTQVQREIVNKHNELRRAVSPPARNMLKMEWNKEAAANAQKWANQCNYRHSNPKDRMTSLKCGENLYMSSASSSWSQAIQSWFDEYNDFDFGVGPKTPNAVVGHYTQVVWYSSYLVGCGNAYCPNQKVLKYYYVCQYCPAGNWANRLYVPYEQGAPCASCPDNCDDGLCTNGCKYEDLYSNCKSLKLTLTCKHQLVRDSCKASCNCSNSIY

Tissue specificity:Salivary gland, pancreas and prostate > epididymis, ovary, thymus and colon.

Induction:

Developmental stage:

Protein families:CRISP family


   💬 WhatsApp