NDUB7_HUMAN   P17568


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P17568

Recommended name:NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7

EC number:

Alternative names:(Cell adhesion protein SQM1) (Complex I-B18) (CI-B18) (NADH-ubiquinone oxidoreductase B18 subunit)

Cleaved into:

GeneID:4713

Gene names  (primary ):NDUFB7

Gene names  (synonym ):

Gene names  (ORF ):

Length:137

Mass:16402

Sequence:MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL

Tissue specificity:

Induction:

Developmental stage:

Protein families:Complex I NDUFB7 subunit family


   💬 WhatsApp