SYUG_HUMAN   O76070


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O76070

Recommended name:Gamma-synuclein

EC number:

Alternative names:(Breast cancer-specific gene 1 protein) (Persyn) (Synoretin) (SR)

Cleaved into:

GeneID:6623

Gene names  (primary ):SNCG

Gene names  (synonym ):BCSG1 PERSYN PRSN

Gene names  (ORF ):

Length:127

Mass:13331

Sequence:MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD

Tissue specificity:Highly expressed in brain, particularly in the substantia nigra. Also expressed in the corpus callosum, heart, skeletal muscle, ovary, testis, colon and spleen. Weak expression in pancreas, kidney and lung.

Induction:

Developmental stage:

Protein families:Synuclein family


   💬 WhatsApp