DB132_HUMAN   Q7Z7B7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q7Z7B7

Recommended name:Beta-defensin 132

EC number:

Alternative names:(Beta-defensin 32) (BD-32) (DEFB-32) (Defensin HEL-75) (Defensin, beta 132)

Cleaved into:

GeneID:400830

Gene names  (primary ):DEFB132

Gene names  (synonym ):DEFB32

Gene names  (ORF ):UNQ827/PRO1754

Length:95

Mass:10610

Sequence:MKFLLLVLAALGFLTQVIPASAGGSKCVSNTPGYCRTCCHWGETALFMCNASRKCCISYSFLPKPDLPQLIGNHWQSRRRNTQRKDKKQQTTVTS

Tissue specificity:

Induction:

Developmental stage:

Protein families:Beta-defensin family


   💬 WhatsApp