ALKL2_HUMAN   Q6UX46


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6UX46

Recommended name:ALK and LTK ligand 2

EC number:

Alternative names:(Augmentor alpha) (AUG-alpha) (Protein FAM150B)

Cleaved into:

GeneID:285016

Gene names  (primary ):ALKAL2

Gene names  (synonym ):FAM150B

Gene names  (ORF ):UNQ542/PRO1097

Length:152

Mass:16915

Sequence:MRGPGHPLLLGLLLVLGAAGRGRGGAEPREPADGQALLRLVVELVQELRKHHSAEHKGLQLLGRDCALGRAEAAGLGPSPEQRVEIVPRDLRMKDKFLKHLTGPLYFSPKCSKHFHRLYHNTRDCTIPAYYKRCARLLTRLAVSPVCMEDKQ

Tissue specificity:Widely expressed with highest levels in adrenal gland and modest levels in pancreas, testis and uterus. {ECO:0000269|PubMed:25331893}.

Induction:

Developmental stage:

Protein families:ALKAL family


   💬 WhatsApp