DNS2B_HUMAN Q8WZ79
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8WZ79
Recommended name：Deoxyribonuclease-2-beta
EC number：EC:3.1.22.1
Alternative names：(DNase II-like acid DNase) (DNase2-like acid DNase) (Deoxyribonuclease II beta) (DNase II beta) (Endonuclease DLAD)
Cleaved into：
GeneID：58511
Gene names (primary )：DNASE2B
Gene names (synonym )：DLAD
Gene names (ORF )：
Length：361
Mass：41713
Sequence：MKQKMMARLLRTSFALLFLGLFGVLGAATISCRNEEGKAVDWFTFYKLPKRQNKESGETGLEYLYLDSTTRSWRKSEQLMNDTKSVLGRTLQQLYEAYASKSNNTAYLIYNDGVPKPVNYSRKYGHTKGLLLWNRVQGFWLIHSIPQFPPIPEEGYDYPPTGRRNGQSGICITFKYNQYEAIDSQLLVCNPNVYSCSIPATFHQELIHMPQLCTRASSSEIPGRLLTTLQSAQGQKFLHFAKSDSFLDDIFAAWMAQRLKTHLLTETWQRKRQELPSNCSLPYHVYNIKAIKLSRHSYFSSYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGGFICTQNWQIYQAFQGLVLYYESCK
Tissue specificity：Highly expressed in the eye lens and in salivary gland. Detected at lower levels in lung, prostate and lymph node. Isoform 2 is lung specific. {ECO:0000269|PubMed:11376952, ECO:0000269|PubMed:11700027, ECO:0000269|PubMed:12944971}.
Induction：
Developmental stage：
Protein families：DNase II family