CBR4_HUMAN Q8N4T8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8N4T8
Recommended name：Carbonyl reductase family member 4
EC number：
Alternative names：(3-ketoacyl-[acyl-carrier-protein] reductase beta subunit) (KAR beta subunit) (3-oxoacyl-[acyl-carrier-protein] reductase) (Quinone reductase CBR4) (Short chain dehydrogenase/reductase family 45C member 1)
Cleaved into：
GeneID：84869
Gene names (primary )：CBR4
Gene names (synonym )：SDR45C1
Gene names (ORF )：
Length：237
Mass：25301
Sequence：MDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEELEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDLKEEHLKKNIPLGRFGETIEVAHAVVFLLESPYITGHVLVVDGGLQLIL
Tissue specificity：Detected in liver and kidney (at protein level). {ECO:0000269|PubMed:19000905}.
Induction：
Developmental stage：
Protein families：Short-chain dehydrogenases/reductases (SDR) family