RARA_HUMAN P10276
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P10276
Recommended name：Retinoic acid receptor alpha
EC number：
Alternative names：(RAR-alpha) (Nuclear receptor subfamily 1 group B member 1)
Cleaved into：
GeneID：5914
Gene names (primary )：RARA
Gene names (synonym )：NR1B1
Gene names (ORF )：
Length：462
Mass：50771
Sequence：MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP
Tissue specificity：Expressed in monocytes. {ECO:0000269|PubMed:26463675}.
Induction：Down-regulated by aging (PubMed:26463675). Induced by pulsatile shear stress (PubMed:28167758). {ECO:0000269|PubMed:26463675, ECO:0000269|PubMed:28167758}.
Developmental stage：
Protein families：Nuclear hormone receptor family, NR1 subfamily