PGDH_HUMAN P15428
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P15428
Recommended name：15-hydroxyprostaglandin dehydrogenase [NAD(+)]
EC number：EC:1.1.1.141
Alternative names：(Prostaglandin dehydrogenase 1) (Short chain dehydrogenase/reductase family 36C member 1)
Cleaved into：
GeneID：3248
Gene names (primary )：HPGD
Gene names (synonym )：PGDH1 SDR36C1
Gene names (ORF )：
Length：266
Mass：28977
Sequence：MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ
Tissue specificity：Detected in colon epithelium (at protein level). {ECO:0000269|PubMed:15574495}.
Induction：Down-regulated by cortisol, dexamethasone and betamethasone. Down-regulated in colon cancer. Up-regulated by TGFB1. {ECO:0000269|PubMed:12788907, ECO:0000269|PubMed:15574495}.
Developmental stage：
Protein families：Short-chain dehydrogenases/reductases (SDR) family