TEX19_HUMAN Q8NA77
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8NA77
Recommended name：Testis-expressed protein 19
EC number：
Alternative names：
Cleaved into：
GeneID：400629
Gene names (primary )：TEX19
Gene names (synonym )：
Gene names (ORF )：
Length：164
Mass：18469
Sequence：MCPPVSMRYEEEGMSYLYASWMYQLQHGDQLSICFTCFKAAFLDFKDLLESEDWEEDNWDPELMEHTEAESEQEGSSGMELSWGQSPGQPVQGGSEAWGPGTLAAAPEGLEDAGLDPHFVPTELWPQEAVPLGLGLEDADWTQGLPWRFEELLTCSHWPSFFPS
Tissue specificity：Expressed in testis. Expressed in undifferentiated embryonic stem cells. {ECO:0000269|PubMed:18096721, ECO:0000269|PubMed:18160741}.
Induction：Down-regulated by gonadotropin suppression sufficient to cause marked suppression of spermatogenesis and additionally progestogen treatment. {ECO:0000269|PubMed:18160741}.
Developmental stage：
Protein families：