FNDC5_HUMAN Q8NAU1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8NAU1
Recommended name：Fibronectin type III domain-containing protein 5
EC number：
Alternative names：(Fibronectin type III repeat-containing protein 2)
Cleaved into：Irisin
GeneID：252995
Gene names (primary )：FNDC5
Gene names (synonym )：FRCP2
Gene names (ORF )：
Length：212
Mass：23659
Sequence：MHPGSPSAWPPRARAALRLWLGCVCFALVQADSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIKDNEPNNNKEKTKSASETSTPEHQGGGLLRSKI
Tissue specificity：Widely expressed, with highest levels in heart. Very low expression, if any, in colon, pancreas and spleen. {ECO:0000269|PubMed:24040023}.
Induction：Has been shown to be up-regulated some twofold by muscular exercise at the mRNA and protein level; this effect has been suggested to be mediated by PPARGC1A (PubMed:22237023). However, up-regulation upon exercise could not be reproduced, at least not at the mRNA level (PubMed:24040023). {ECO:0000269|PubMed:22237023, ECO:0000269|PubMed:24040023}.
Developmental stage：
Protein families：