CDN1B_HUMAN   P46527


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P46527

Recommended name:Cyclin-dependent kinase inhibitor 1B

EC number:

Alternative names:(Cyclin-dependent kinase inhibitor p27) (p27Kip1)

Cleaved into:

GeneID:1027

Gene names  (primary ):CDKN1B

Gene names  (synonym ):KIP1

Gene names  (ORF ):

Length:198

Mass:22073

Sequence:MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT

Tissue specificity:Expressed in all tissues tested. Highest levels in skeletal muscle, lowest in liver and kidney.

Induction:Maximal levels in quiescence cells and early G(1). Levels decrease after mitogen stimulation as cells progress toward S-phase. {ECO:0000269|PubMed:17254966}.

Developmental stage:

Protein families:CDI family


   💬 WhatsApp