TP8L1_HUMAN Q8WVP5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8WVP5
Recommended name：Tumor necrosis factor alpha-induced protein 8-like protein 1
EC number：
Alternative names：(TIPE1) (TNF alpha-induced protein 8-like protein 1) (TNFAIP8-like protein 1) (Oxidative stress-regulated gene-beta) (Oxy-beta)
Cleaved into：
GeneID：126282
Gene names (primary )：TNFAIP8L1
Gene names (synonym )：
Gene names (ORF )：
Length：186
Mass：20827
Sequence：MDTFSTKSLALQAQKKLLSKMASKAVVAVLVDDTSSEVLDELYRATREFTRSRKEAQKMLKNLVKVALKLGLLLRGDQLGGEELALLRRFRHRARCLAMTAVSFHQVDFTFDRRVLAAGLLECRDLLHQAVGPHLTAKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEGLGRMLDEGSL
Tissue specificity：High expression detected in most carcinoma cell lines, especially in cells transformed with virus genomes. {ECO:0000269|PubMed:21600655}.
Induction：Up-regulated by oxidative stress (OS) at both transcriptional and translational levels. {ECO:0000269|PubMed:24444419}.
Developmental stage：
Protein families：TNFAIP8 family