RN185_HUMAN Q96GF1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96GF1
Recommended name：E3 ubiquitin-protein ligase RNF185
EC number：EC:2.3.2.27
Alternative names：(RING finger protein 185) (RING-type E3 ubiquitin transferase RNF185)
Cleaved into：
GeneID：91445
Gene names (primary )：RNF185
Gene names (synonym )：
Gene names (ORF )：
Length：192
Mass：20459
Sequence：MASKGPSASASPENSSAGGPSGSSNGAGESGGQDSTFECNICLDTAKDAVISLCGHLFCWPCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVPGTPQYVDEQFLSRLFLFVALVIMFWLLIA
Tissue specificity：Ubiquitously expressed. {ECO:0000269|PubMed:27485036}.
Induction：Up-regulated by unfolded protein response (UPR) and endoplasmic reticulum (ER) stress triggered by thapsigargin or tunicamycin. {ECO:0000269|PubMed:24019521, ECO:0000269|PubMed:27485036}.
Developmental stage：
Protein families：