FA72A_HUMAN Q5TYM5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5TYM5
Recommended name：Protein FAM72A
EC number：
Alternative names：(Latent membrane protein 1-induced protein) (LMP1-induced protein) (LMPIP)
Cleaved into：
GeneID：729533
Gene names (primary )：FAM72A
Gene names (synonym )：UGENE
Gene names (ORF )：
Length：149
Mass：16619
Sequence：MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCYFTKICKCKLKDIACLKCGNIVGYHVIVPCSSCLLSCNNGHFWMFHSQAVYDINRLDSTGVNVLLWGNLPEIEESTDEDVLNISAEECIR
Tissue specificity：May be up-regulated in malignant colon cancers, compared to normal colon and colon adenomas. Expression is also elevated in other common cancer types, including breast, lung, uterus, and ovary. {ECO:0000269|PubMed:18676834}.
Induction：Up-regulated in peripheral blood mononuclear cells following Epstein-Barr virus (EBV) infection or following transfection with EBV LMP1 protein. {ECO:0000269|PubMed:21317926}.
Developmental stage：
Protein families：FAM72 family