IL31_HUMAN Q6EBC2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6EBC2
Recommended name：Interleukin-31
EC number：
Alternative names：(IL-31)
Cleaved into：
GeneID：386653
Gene names (primary )：IL31
Gene names (synonym )：
Gene names (ORF )：
Length：164
Mass：18205
Sequence：MASHSGPSTSVLFLFCCLGGWLASHTLPVRLLRPSDDVQKIVEELQSLSKMLLKDVEEEKGVLVSQNYTLPCLSPDAQPPNNIHSPAIRAYLKTIRQLDNKSVIDEIIEHLDKLIFQDAPETNISVPTDTHECKRFILTISQQFSECMDLALKSLTSGAQQATT
Tissue specificity：Detected at low levels in testis, bone marrow, skeletal muscle, kidney, colon, thymus, small intestine and trachea. {ECO:0000269|PubMed:15184896}.
Induction：Up-regulated in skin homing T-cells of patients with atopic dermatitis (AD) and in activated circulating T-cells. Up-regulated in lesional biopsies of patients with allergic contact dermatitis (ACD). {ECO:0000269|PubMed:16461143, ECO:0000269|PubMed:17030248}.
Developmental stage：
Protein families：