NNAT_HUMAN Q16517
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q16517
Recommended name：Neuronatin
EC number：
Alternative names：
Cleaved into：
GeneID：4826
Gene names (primary )：NNAT
Gene names (synonym )：
Gene names (ORF )：
Length：81
Mass：9237
Sequence：MAAVAAASAELLIIGWYIFRVLLQVFLECCIYWVGFAFRNPPGTQPIARSEVFRYSLQKLAYTVSRTGRQVLGERRQRAPN
Tissue specificity：
Induction：
Developmental stage：Abundant in 18-24 week old fetal brain. Postnatally its expression decline and only minimal levels were present in adulthood.
Protein families：Neuronatin family