PSB10_HUMAN P40306
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P40306
Recommended name：Proteasome subunit beta type-10
EC number：EC:3.4.25.1
Alternative names：(Low molecular mass protein 10) (Macropain subunit MECl-1) (Multicatalytic endopeptidase complex subunit MECl-1) (Proteasome MECl-1) (Proteasome subunit beta-2i)
Cleaved into：
GeneID：5699
Gene names (primary )：PSMB10
Gene names (synonym )：LMP10 MECL1
Gene names (ORF )：
Length：273
Mass：28936
Sequence：MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE
Tissue specificity：
Induction：Up-regulated by IFNG/IFN-gamma (at protein level). Up-regulated by IRF1. Up-regulated by TNF (at protein level). Up-regulated by tetrodotoxin (TTX) in glial cells. Up-regulated in Crohn's bowel disease (CD). Up-regulated by CD40L via the NFKB1 pathway in cancer cells. {ECO:0000269|PubMed:10575004, ECO:0000269|PubMed:11493458, ECO:0000269|PubMed:15501285, ECO:0000269|PubMed:15907481, ECO:0000269|PubMed:17262812, ECO:0000269|PubMed:18694960, ECO:0000269|PubMed:8666937}.
Developmental stage：Highly expressed in immature dendritic cells (at protein level). {ECO:0000269|PubMed:11717192}.
Protein families：Peptidase T1B family