TRAT1_HUMAN Q6PIZ9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6PIZ9
Recommended name：T-cell receptor-associated transmembrane adapter 1
EC number：
Alternative names：(T-cell receptor-interacting molecule) (TRIM) (pp29/30)
Cleaved into：
GeneID：50852
Gene names (primary )：TRAT1
Gene names (synonym )：TCRIM
Gene names (ORF )：HSPC062
Length：186
Mass：21211
Sequence：MSGISGCPFFLWGLLALLGLALVISLIFNISHYVEKQRQDKMYSYSSDHTRVDEYYIEDTPIYGNLDDMISEPMDENCYEQMKARPEKSVNKMQEATPSAQATNETQMCYASLDHSVKGKRRKPRKQNTHFSDKDGDEQLHAIDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGLIRAKREPIN
Tissue specificity：Strongly expressed in thymus, and to a lesser extent in spleen, lymph node and peripheral blood lymphocytes. Present in T-cells and NK cells, but not B-cells (at protein level). {ECO:0000269|PubMed:16160011, ECO:0000269|PubMed:9687533}.
Induction：
Developmental stage：Strongly expressed in fetal thymus at weeks 17-24 of gestation. Undetectable in bone marrow and fetal liver. {ECO:0000269|PubMed:9687533}.
Protein families：