C1QB_MOUSE P14106
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P14106
Recommended name：Complement C1q subcomponent subunit B
EC number：
Alternative names：
Cleaved into：
GeneID：12260
Gene names (primary )：C1qb
Gene names (synonym )：
Gene names (ORF )：
Length：253
Mass：26717
Sequence：MKTQWGEVWTHLLLLLLGFLHVSWAQSSCTGPPGIPGIPGVPGVPGSDGQPGTPGIKGEKGLPGLAGDLGEFGEKGDPGIPGTPGKVGPKGPVGPKGTPGPSGPRGPKGDSGDYGATQKVAFSALRTINSPLRPNQVIRFEKVITNANENYEPRNGKFTCKVPGLYYFTYHASSRGNLCVNLVRGRDRDSMQKVVTFCDYAQNTFQVTTGGVVLKLEQEEVVHLQATDKNSLLGIEGANSIFTGFLLFPDMDA
Tissue specificity：Highest expression in thioglycolate-activated peritoneal macrophages. Also found in spleen, thymus and heart. Very weak expression liver, kidney, lung and intestine. {ECO:0000269|PubMed:2591537}.
Induction：
Developmental stage：
Protein families：