TM208_MOUSE   Q9CR96


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CR96

Recommended name:Transmembrane protein 208

EC number:

Alternative names:

Cleaved into:

GeneID:66320

Gene names  (primary ):Tmem208

Gene names  (synonym ):

Gene names  (ORF ):

Length:173

Mass:19624

Sequence:MAPKGKVGTRGKKQIFEENKETLKFYLRIILGANAIYCLVTLVFFYSSASFWAWMALGFSLAVYGASYHSMSSMARASFSEDGSLMDGGMDLNMEQGMAEHLKDVILLTAIVQVLSCFSLYIWSFWLLAPGRALYLLWVNVLGPWFTADSGAPAPELNEKRQRRQERRQMKRL

Tissue specificity:

Induction:

Developmental stage:

Protein families:TMEM208 family


   💬 WhatsApp