TCC1_MOUSE   P01853


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P01853

Recommended name:T-cell receptor gamma chain C region C10.5

EC number:

Alternative names:

Cleaved into:

GeneID:

Gene names  (primary ):

Gene names  (synonym ):

Gene names  (ORF ):

Length:167

Mass:19101

Sequence:DKRLDADISPKPTIFLPSVAETNLHKTGTYLCLLEKFFPDVIRVYWKEKNGNTILDSQEGDTLKTKGTYMKFSWLTVPERAMGKEHSCIVKHENNKGGADQEIFFPSIKKVATTCWQDKNDVLQFQFTSTSAYYTYLLLLLKSVIYLAIISFSLLRRTSVCGNEKKS

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp