ZBT14_MOUSE Q08376
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q08376
Recommended name:Zinc finger and BTB domain-containing protein 14
EC number:
Alternative names:(Zinc finger protein 161) (Zfp-161) (Zinc finger protein 5) (ZF5)
Cleaved into:
GeneID:22666
Gene names (primary ):Zbtb14
Gene names (synonym ):Zfp-5 Zfp161 Zfp5
Gene names (ORF ):
Length:449
Mass:50899
Sequence:MEFFISMSETIKYNDDDHKTLFLKTLNEQRLEGEFCDIAIVVEDVKFRAHRCVLAACSTYFKKLFKKLEVDSSSVIEIDFLRSDIFEEVLNYMYTAKISVKKEDVNLMMSSGQILGIRFLDKLCSQKRDVSSPDESNGQSKSKYCLKLNRPIGDAADAQDDDVEEIGDQDDSPSDDTVEGTPPSQEDGKSPTTTLRVQEAILKELGSEEVRKVNCYGQEVESMETPESKDLGSQTPQALTFNDGMSEVKDEQTPGWTTAASDMKFEYLLYGHHREQIACQACGKTFSDEGRLRKHEKLHTADRPFVCEMCTKGFTTQAHLKEHLKIHTGYKPYSCEVCGKSFIRAPDLKKHERVHSNERPFACHMCDKAFKHKSHLKDHERRHRGEKPFVCGSCTKAFAKASDLKRHENNMHSERKQVTPSAIQSETEQLQAAAMAAEAEQQLETIACS
Tissue specificity:Ubiquitous. {ECO:0000269|PubMed:8367294}.
Induction:
Developmental stage:
Protein families:Krueppel C2H2-type zinc-finger protein family