TAF7L_MOUSE Q9D3R9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D3R9
Recommended name：Transcription initiation factor TFIID subunit 7-like
EC number：
Alternative names：(TATA box binding protein-associated factor RNA polymerase II subunit Q) (TATA box-binding protein-associated factor 50 kDa) (Transcription initiation factor TFIID 50 kDa subunit)
Cleaved into：
GeneID：74469
Gene names (primary )：Taf7l
Gene names (synonym )：Taf2q
Gene names (ORF )：
Length：471
Mass：52905
Sequence：MERGEEAPTEGAPPEGALVEAKAPVIPEAPATDVSTTEEAGSKEPQVPSGPRPEGAGDTCDTRGARGPPTPGRAKSQKTPRQGTARCQTLESAMRSMSVRLECHDVEEQFILRLPPEQAYAVRKIIHSRNAAWKDKLKIDFSPDGHHAVVQVDNVSLPAKLVNLPCVIGSLKTIDRKTFYKTADVSQMLVCSPEGEPHSPPEEPVVSTGPTVIGISEGKAERKKYNWKHGITPPLKNVRKKRFRKTTKKLPDVKQVDEINFSEYTQSPSVEKEVKRLLYSDAEAVSVRWEVVDDDDAKEIESQGSMPTTPGISQMGGASLSDYDVFREMMGDSGSNSNDVEEKSNEGDDDDDEDEDDEDYGNEKEEEETDNSEEELEKELQAKFNEFSLHEADQDYSSITMAIQKLIFIKEKRLQMIYKKAQRQKELLRKVENLTLKRHFQNVLGKLNIMEKEKCEQIYHLQEQLKCFLKE
Tissue specificity：Testis-specific (at protein level). Expressed during spermatogenesis from spermatogonia stage up to the stage of round spermatids. {ECO:0000269|PubMed:11279525, ECO:0000269|PubMed:17242199}.
Induction：
Developmental stage：
Protein families：TAF7 family