ZSWM7_MOUSE   Q9CWQ2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CWQ2

Recommended name:Zinc finger SWIM domain-containing protein 7

EC number:

Alternative names:(SWIM domain-containing and Srs2-interacting protein 1 homolog)

Cleaved into:

GeneID:69747

Gene names  (primary ):Zswim7

Gene names  (synonym ):Sws1

Gene names  (ORF ):

Length:152

Mass:16658

Sequence:MAVALPEVVEELLSEMAAAVRDSARIPDELLLSLEFVFGSSAIQALDLVDRESVTLISSPSGRRVYQVLGSSGKTYTCLASCHYCSCPAFSFSVLRKSDSLLCKHLLAIYLSQLLRNCQQLHVSDKQLTDLLMEDTRRIKGAAGTWTSKTEA

Tissue specificity:

Induction:

Developmental stage:

Protein families:SWS1 family


   💬 WhatsApp