STAR_MOUSE   P51557


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P51557

Recommended name:Steroidogenic acute regulatory protein, mitochondrial

EC number:

Alternative names:(StAR) (Luteinizing hormone-induced protein) (START domain-containing protein 1) (StARD1)

Cleaved into:

GeneID:20845

Gene names  (primary ):Star

Gene names  (synonym ):

Gene names  (ORF ):

Length:284

Mass:31626

Sequence:MFLATFKLCAGSSYRHMRNMKGLRHQAVLAIGQELNWRALGDSSPGWMGQVRRRSSLLGSQLEATLYSDQELSYIQQGEVAMQKALGILNNQEGWKKESQQENGDEVLSKMVPDVGKVFRLEVVVDQPMDRLYEELVDRMEAMGEWNPNVKEIKVLQRIGKDTVITHELAAAAAGNLVGPRDFVSVRCTKRRGSTCVLAGMATHFGEMPEQSGVIRAEHGPTCMVLHPLAGSPSKTKLTWLLSIDLKGWLPKTIINQVLSQTQIEFANHLRKRLEASPASEAQC

Tissue specificity:Expressed within glia and neurons in discrete regions of the brain. {ECO:0000269|PubMed:12486153}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp