SCTR_MOUSE   Q5FWI2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5FWI2

Recommended name:Secretin receptor

EC number:

Alternative names:(SCT-R)

Cleaved into:

GeneID:319229

Gene names  (primary ):Sctr

Gene names  (synonym ):

Gene names  (ORF ):

Length:447

Mass:50932

Sequence:MLSTMSPRLSLLLLWLLLLINAAHPVGALPRLCDVRRVLLEERAECLRELSEEKKALGPKTASGCERFWDNMSCWPSSALAQTVEVPCPKFLRMFSGRNGSLFRNCTKDGWSETFPRPDLACGVNMNGSFNERRHAYLLKLKVMYTVGYSSSLAMLLVALSILCSFRRLHCTRNYIHMHLFVSFILRALSNFIKDAVLFPADDVTYCDAHRAGCKLVMIFFQYCIMANYAWLLVEGLYLHTLLAISFFSERKCLQAFVLFGWGSPAIFVALWAVTRHFLEDFGCWDINSNASIWWVIRGPVILSIVINFIFFINILRILMRKLRTQETRGNETHHYKRLAKSTLLLIPLFGIHYIVFAFSPEGAMEVQLFFELALGSFQGLVVAVLYCFLNGELEVQKKWRQWHLQEFPLRPVALSNSFSNATNGPTHSTKAGTSEQSRSIPGANVI

Tissue specificity:In brain, expressed in the hippocampal CA1 region, the lower layer of cerebral cortex, the anterior olfactory nuclei, the anterior ventrolateral thalamus, the lateral region of hypothalamus, substantia nigra, tegmental area and central nucleus of the inferior colliculus, the ventral supramamillary nucleus and the cerebellum (PubMed:17008357). Expressed in brown adipocytes: expression predominates in mature brown adipocytes (at protein level) (PubMed:30449620). {ECO:0000269|PubMed:17008357, ECO:0000269|PubMed:30449620}.

Induction:

Developmental stage:

Protein families:G-protein coupled receptor 2 family


   💬 WhatsApp