RPP21_MOUSE   Q8R040


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8R040

Recommended name:Ribonuclease P protein subunit p21

EC number:EC 3.1.26.5

Alternative names:(RNaseP protein p21) (Ribonucleoprotein V)

Cleaved into:

GeneID:67676

Gene names  (primary ):Rpp21

Gene names  (synonym ):Cat60

Gene names  (ORF ):

Length:150

Mass:17243

Sequence:MAGPVKDREAFQRLSFLYQAAHCVLSQNPENQALARFYCHTEKTIAKRLVLRQDPSVKRTLCRSCSSLLIPGLTCTQRQRRRKGQRWTVQTCLTCQRSQRFLNDPKHLLWGDRPEAQLENQADINPSEPLPNIADLPKENIQTQALNTSE

Tissue specificity:

Induction:

Developmental stage:

Protein families:Eukaryotic/archaeal RNase P protein component 4 family


   💬 WhatsApp