RPC4_MOUSE Q91WD1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91WD1
Recommended name：DNA-directed RNA polymerase III subunit RPC4
EC number：
Alternative names：(RNA polymerase III subunit C4) (DNA-directed RNA polymerase III subunit D)
Cleaved into：
GeneID：67065
Gene names (primary )：Polr3d
Gene names (synonym )：Bn51t
Gene names (ORF )：
Length：398
Mass：44357
Sequence：MSEGNAAGEPSNPGGPRPLLSGGRGLIGRRPAPPLTPGRLPSIRSRDLTLGGVKKKTFTPNIISRKIKEEPKEEVTMKKEKRERDRDRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKKGNWDKTVDMSDMGPSHIINIKKEKRETDEETKQILRMLEKDDFIDDPGLKNDTRNMPVQLPLAHSGWLFKEESEEPEAKPFSAGPKEEDMEVDVPAVKVKEEPRDEEEEAKVKAPPRAARKTPGLPKDVSVAELLRELSLMKDEELLFLQLPDTLPGQPPTQDIKPVKTEVQGEDGQMVVIKQEKDREARLAENACTLADLTEGQVGKLLIRKSGKVQLLLGKVTLDVTMGTTCSFLQELVSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDHKHR
Tissue specificity：
Induction：
Developmental stage：
Protein families：Eukaryotic RPC4/POLR3D RNA polymerase subunit family