OZF_MOUSE Q8BQN6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BQN6
Recommended name：Zinc finger protein OZF
EC number：
Alternative names：(Only zinc finger protein) (Zinc finger protein 146)
Cleaved into：
GeneID：26465
Gene names (primary )：Znf146
Gene names (synonym )：Ozf Zfp146
Gene names (ORF )：
Length：292
Mass：33093
Sequence：MSQLSQQRILSGGSPFACKVCGKLFSHKSNLTEHEHFHSREKPFECNECGKAFSQKQYVIKHQSTHSGEKLFECSDCGKAFSQKENLLTHQKIHTGEKPFECKDCGKAFIQKSNLIRHQRTHTGEKPFICKECGKTFSGKSNLTEHEKIHIGEKPFKCNECGTAFGQKKYLIKHQNIHTGEKPYECNECGKAFSQRTSLIVHVRIHSGDKPYECNVCGKAFSQSSSLTVHVRSHTGEKPYGCNECGKAFSQFSTLALHLRIHTGKKPYQCSECGKAFSQKSHHIRHQKIHTH
Tissue specificity：Expressed in heart, brain, liver, lung, skeletal muscle and kidney, and at much lower level in spleen and testicle. Expressed in lactating mammary gland. {ECO:0000269|PubMed:10449921, ECO:0000269|PubMed:12437081}.
Induction：
Developmental stage：
Protein families：Krueppel C2H2-type zinc-finger protein family