MDFI_MOUSE P70331
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P70331
Recommended name：MyoD family inhibitor
EC number：
Alternative names：(Myogenic repressor I-mf)
Cleaved into：
GeneID：17240
Gene names (primary )：Mdfi
Gene names (synonym )：
Gene names (ORF )：
Length：251
Mass：26013
Sequence：MSQVSGQCPSRCDAPHGVPSAALDPAQTMSLLPGLEVARSTHPVEASSEEGFPEEAAPSMPHDSGLRAQQALNSIDLDVPTEAVTCQPQGNPQGCTPLLPNGSSHDHLSEPGSAGHAGNGALGGSKAHRKLQTHPSLGSQAGRKSRGSARSASQVPLQAQEGKAPAVRIHRQTASPTCCLRNAQLSGTALRSLRLESQGHRELNNKTLSQSNNKKPGVAAHAAIIPALTRPKQNCHDPSLLPGTHGVGKEF
Tissue specificity：In the embryo, highly expressed in the sclerotome. Also expressed in the notochord, neural tube, limb buds, heart, branchial arches and head mesenchyme. In the adult, highly expressed in skeletal muscle. Expressed at lower levels in most other tissues. {ECO:0000269|PubMed:8797820}.
Induction：
Developmental stage：
Protein families：MDFI family