TIM16_MOUSE Q9CQV1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CQV1
Recommended name：Mitochondrial import inner membrane translocase subunit TIM16
EC number：
Alternative names：(Mitochondria-associated granulocyte macrophage CSF-signaling molecule) (Presequence translocated-associated motor subunit PAM16)
Cleaved into：
GeneID：66449
Gene names (primary )：Pam16
Gene names (synonym )：Magmas Tim16 Timm16
Gene names (ORF )：
Length：125
Mass：13785
Sequence：MAKYLAQIIVMGVQVVGRAFARALRQEFAASQAAADARGRAGHQSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELRIQAQEDREKGQKPKT
Tissue specificity：Expressed in trabecular bone and cartilage and by differentiated chondrocytes localized in the hypertrophic zone and by osteoblasts at early developmental stages. {ECO:0000269|PubMed:24786642}.
Induction：
Developmental stage：
Protein families：TIM16/PAM16 family