KCIP1_MOUSE Q9JJ57
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JJ57
Recommended name：Kv channel-interacting protein 1
EC number：
Alternative names：(KChIP1) (A-type potassium channel modulatory protein 1) (Potassium channel-interacting protein 1)
Cleaved into：
GeneID：70357
Gene names (primary )：Kcnip1
Gene names (synonym )：Kchip1
Gene names (ORF )：
Length：227
Mass：26831
Sequence：MGAVMGTFSSLQTKQRRPSKDIAWWYYQYQRDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRGFKNECPSGVVNEETFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVM
Tissue specificity：Expressed in brain. Found in a subpopulation of neurons widely distributed and enriched in Purkinje cells of the cerebellum and in the reticular thalamic and medial habenular nuclei. {ECO:0000269|PubMed:14572458, ECO:0000269|PubMed:15363885}.
Induction：
Developmental stage：
Protein families：Recoverin family