IFT25_MOUSE   Q9D6H2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D6H2

Recommended name:Intraflagellar transport protein 25 homolog

EC number:

Alternative names:(Heat shock protein beta-11) (Hspb11) (Placental protein 25) (PP25)

Cleaved into:

GeneID:72938

Gene names  (primary ):Hspb11

Gene names  (synonym ):Ift25

Gene names  (ORF ):

Length:143

Mass:16281

Sequence:MRKVDLCSVTEGTEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVKIEKLVIQSYLVRTLRIEKTTSKEPLDFEQWVEKDLVHTEGQLQNEEIVARDGYATFLRFIIVSAFDHFASVHSISAEGLTVSSLP

Tissue specificity:Expressed predominantly in the testis (at protein level). {ECO:0000269|PubMed:28430876, ECO:0000269|PubMed:28964737}.

Induction:

Developmental stage:

Protein families:IFT25 family


   💬 WhatsApp