FCGRN_MOUSE Q61559
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q61559
Recommended name：IgG receptor FcRn large subunit p51
EC number：
Alternative names：(FcRn) (IgG Fc fragment receptor transporter alpha chain) (Neonatal Fc receptor)
Cleaved into：
GeneID：14132
Gene names (primary )：Fcgrt
Gene names (synonym )：Fcrn
Gene names (ORF )：
Length：365
Mass：40093
Sequence：MGMPLPWALSLLLVLLPQTWGSETRPPLMYHLTAVSNPSTGLPSFWATGWLGPQQYLTYNSLRQEADPCGAWMWENQVSWYWEKETTDLKSKEQLFLEALKTLEKILNGTYTLQGLLGCELASDNSSVPTAVFALNGEEFMKFNPRIGNWTGEWPETEIVANLWMKQPDAARKESEFLLNSCPERLLGHLERGRRNLEWKEPPSMRLKARPGNSGSSVLTCAAFSFYPPELKFRFLRNGLASGSGNCSTGPNGDGSFHAWSLLEVKRGDEHHYQCQVEHEGLAQPLTVDLDSSARSSVPVVGIVLGLLLVVVAIAGGVLLWGRMRSGLPAPWLSLSGDDSGDLLPGGNLPPEAEPQGANAFPATS
Tissue specificity：Intestinal epithelium of suckling rodents. Expressed in neonatal intestine and fetal yolk sac. {ECO:0000269|PubMed:7504013}.
Induction：
Developmental stage：
Protein families：Immunoglobulin superfamily