COQ7_MOUSE   P97478


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P97478

Recommended name:5-demethoxyubiquinone hydroxylase, mitochondrial

EC number:EC 1.14.99.60

Alternative names:(DMQ hydroxylase) (Timing protein clk-1 homolog) (Ubiquinone biosynthesis monooxygenase COQ7)

Cleaved into:

GeneID:12850

Gene names  (primary ):Coq7

Gene names  (synonym ):

Gene names  (ORF ):

Length:217

Mass:24042

Sequence:MSAAGAIAAASVGRLRTGVRRPFSEYGRGLIIRCHSSGMTLDNINRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKNHLKKFNELMIAFRVRPTVLMPLWNVAGFALGAGTALLGKEGAMACTVAVEESIANHYNNQIRMLMEEDPEKYEELLQVIKQFRDEELEHHDTGLDHDAELAPAYALLKRIIQAGCSAAIYLSERF

Tissue specificity:Highly expressed in tissues with high energy demand such as heart, muscle, liver, and kidney. {ECO:0000269|PubMed:11511092}.

Induction:

Developmental stage:

Protein families:COQ7 family


   💬 WhatsApp