5NT1B_MOUSE   Q91YE9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q91YE9

Recommended name:Cytosolic 5'-nucleotidase 1B

EC number:EC 3.1.3.5

Alternative names:(cN1B) (Autoimmune infertility-related protein) (Cytosolic 5'-nucleotidase IB) (cN-IB)

Cleaved into:

GeneID:70881

Gene names  (primary ):Nt5c1b

Gene names  (synonym ):Airp

Gene names  (ORF ):

Length:573

Mass:65002

Sequence:MSQTSLKHKKKNEPGMRYSKESLDAEKRKDSDKTGARLSTQGSQELPLHNTDSRGYVVRNQWSRTSRSPSTGAPSVDEPRSRNTAIKVEAPNSSTTSRTSSASPSQHETSPPPQTSEKSSIQQTPQNRPITQLESQPPTPPETEPNSRRTSAKMYTGSDPWAHRENREPRDLQLRDYAYSCDSREGMPKTREYPRTPPTEWKPYAQRRLQYGTSVDMEPEYISDGPQQRQRQQTEEDEVDEAYWTSVSMLYEKIPSCARPRPPKPKHAITIAVSSRALFNMVDDRKIYEEEGLEKYMEYQLTNENVILTPGPAFRFVKALQHVNSRLRDLYPDEQDLFDIVLMTNNHAQVGVRLINSVNHYGLLIDRFCLTGGKSPIGYLKAYLTNLYLSADSEKVQEAIKEGIASATMYAGAKDMAYCDTQLRVAFDGDAVLFSDESEHIAKDHGLDKFFQHETLFENKPLAQGPLKSFLEDLGKLQKKFYAKDERLLCPIRTYLVTARSAASSGARVLKTLRRWGLEIDEALFLAGAPKGPILVKIRPHIFFDDQMFHIESAQKFGTITAHVPYGIAQKRN

Tissue specificity:Highly expressed in testis and brain. Detected at lower levels in skeletal muscle, heart and kidney. {ECO:0000269|PubMed:11690631}.

Induction:

Developmental stage:

Protein families:5'-nucleotidase type 3 family


   💬 WhatsApp