KLRBF_MOUSE Q8VD98
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8VD98
Recommended name：Killer cell lectin-like receptor subfamily B member 1F
EC number：
Alternative names：(CD161 antigen-like family member F) (Natural killer cell surface protein NKR-P1F) (CD antigen CD161f)
Cleaved into：
GeneID：232408
Gene names (primary )：Klrb1f
Gene names (synonym )：Nkrp1f
Gene names (ORF )：
Length：217
Mass：24681
Sequence：MDTSKVHGNVKPFRCPGYKQASSPSFSPDACRCPHWHHLALKSGCAGLILLLLSLIGLSVLVRFLVQKPPIEKCSVAAQENRTELTGRSAILECPRYWHPHWNKCLFVSQISRPWAEGRDACSMEDAILLLIENKEELRFVQNLIKGKEQLFFIGLKYVQKEKIWKWIDGSILNPNLLRITGKDKENSCAIISHTEVFSDSCSSDNHWICQKTLIHV
Tissue specificity：Highly expressed in dendritic cells. Detectable in natural killer cells. {ECO:0000269|PubMed:15963483}.
Induction：
Developmental stage：
Protein families：