BAF_MOUSE   O54962


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O54962

Recommended name:Barrier-to-autointegration factor

EC number:

Alternative names:(Breakpoint cluster region protein 1) (LAP2-binding protein 1)

Cleaved into:Barrier-to-autointegration factor, N-terminally processed

GeneID:23825

Gene names  (primary ):Banf1

Gene names  (synonym ):Baf Bcrp1 L2bp1

Gene names  (ORF ):

Length:89

Mass:10103

Sequence:MTTSQKHRDFVAEPMGEKPVGSLAGIGDVLSKRLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL

Tissue specificity:

Induction:

Developmental stage:

Protein families:BAF family


   💬 WhatsApp