DFB35_MOUSE   Q8R2I3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8R2I3

Recommended name:Beta-defensin 35

EC number:

Alternative names:(BD-35) (mBD-35) (Defensin, beta 35)

Cleaved into:

GeneID:246084

Gene names  (primary ):Defb35

Gene names  (synonym ):

Gene names  (ORF ):

Length:63

Mass:7397

Sequence:MPQTFFVFCFLFFVFLQLFPGTGEIAVCETCRLGRGKCRRACIESEKIVGWCKLNFFCCRERI

Tissue specificity:Expressed in testis, epididymis (caput, corpus and cauda), kidney and neonatal and adult brain. {ECO:0000269|PubMed:12644567, ECO:0000269|PubMed:14718547}.

Induction:

Developmental stage:

Protein families:Beta-defensin family


   💬 WhatsApp