TM11D_MOUSE Q8VHK8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8VHK8
Recommended name：Transmembrane protease serine 11D
EC number：EC 3.4.21.-
Alternative names：(Adrenal secretory serine protease) (AsP) (Airway trypsin-like protease) (AT)
Cleaved into：Transmembrane protease serine 11D non-catalytic chain; Transmembrane protease serine 11D catalytic chain
GeneID：231382
Gene names (primary )：Tmprss11d
Gene names (synonym )：Mat
Gene names (ORF )：
Length：417
Mass：46254
Sequence：MYRPRPMLSPSRFFTPFAVAFVVIITVGLLAMMAGLLIHFLAFDKKAYFYHSSFQILNVEYTEALNSPATHEYRTLSERIEAMITDEFRGSSLKSEFIRTHVVKLRKEGTGVVADVVMKFRSSKRNNRKVMKTRIQSVLRRLSSSGNLEIAPSNEITSLTDQDTENVLTQECGARPDLITLSEERIIGGMQAEPGDWPWQVSLQLNNVHHCGGALISNMWVLTAAHCFKSYPNPQYWTATFGVSTMSPRLRVRVRAILAHDGYSSVTRDNDIAVVQLDRSVAFSRNIHRVCLPAATQNIIPGSVAYVTGWGSLTYGGNAVTNLRQGEVRIISSEECNTPAGYSGSVLPGMLCAGMRSGAVDACQGDSGGPLVQEDSRRLWFVVGIVSWGYQCGLPNKPGVYTRVTAYRNWIRQQTGI
Tissue specificity：Highly expressed in the esophagus, tongue, and trachea, low expression was seen in heart, lung, and adrenal gland. Isoform 2 is also highly expressed in the adrenal gland. {ECO:0000269|PubMed:14691009}.
Induction：
Developmental stage：
Protein families：Peptidase S1 family