ARL8A_MOUSE   Q8VEH3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8VEH3

Recommended name:ADP-ribosylation factor-like protein 8A

EC number:

Alternative names:(ADP-ribosylation factor-like protein 10B) (Novel small G protein indispensable for equal chromosome segregation 2)

Cleaved into:

GeneID:68724

Gene names  (primary ):Arl8a

Gene names  (synonym ):Arl10b Gie2

Gene names  (ORF ):

Length:186

Mass:21390

Sequence:MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLAGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS

Tissue specificity:

Induction:

Developmental stage:

Protein families:Small GTPase superfamily, Arf family


   💬 WhatsApp