CCL22_MOUSE O88430
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88430
Recommended name：C-C motif chemokine 22
EC number：
Alternative names：(Activated B and dendritic cell-derived) (CC chemokine ABCD-1) (Small-inducible cytokine A22)
Cleaved into：
GeneID：20299
Gene names (primary )：Ccl22
Gene names (synonym )：Abcd1 Scya22
Gene names (ORF )：
Length：92
Mass：10302
Sequence：MATLRVPLLVALVLLAVAIQTSDAGPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITVKNRDICADPRQVWVKKLLHKLS
Tissue specificity：Expressed by activated splenic B-lymphocytes and dendritic cells. Low expression in lung, thymocytes, lymph node, and unstimulated splenic cells.
Induction：
Developmental stage：
Protein families：Intercrine beta (chemokine CC) family