DDIT3_MOUSE P35639
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P35639
Recommended name：DNA damage-inducible transcript 3 protein
EC number：
Alternative names：(DDIT-3) (C/EBP zeta) (C/EBP-homologous protein) (CHOP) (C/EBP-homologous protein 10) (CHOP-10) (CCAAT/enhancer-binding protein homologous protein) (Growth arrest and DNA-damage-inducible protein GADD153)
Cleaved into：
GeneID：13198
Gene names (primary )：Ddit3
Gene names (synonym )：Chop Chop10 Gadd153
Gene names (ORF )：
Length：168
Mass：19189
Sequence：MAAESLPFTLETVSSWELEAWYEDLQEVLSSDEIGGTYISSPGNEEEESKTFTTLDPASLAWLTEEPGPTEVTRTSQSPRSPDSSQSSMAQEEEEEEQGRTRKRKQSGQCPARPGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVETTRRALIDRMVSLHQA
Tissue specificity：
Induction：[Isoform 1]: By various stress, such as oxidative stress, amino-acid deprivation, hypoxia and ER stress (PubMed:16670335, PubMed:19752026, PubMed:19855386, PubMed:19919955, PubMed:21159964, PubMed:22242125). Specifically produced in response to stress: in absence of stress, AltDDIT3, the upstream ORF of this bicistronic gene, is translated, thereby preventing its translation (PubMed:21285359). During ER stress, induced by a EIF2AK3/ATF4 pathway and/or ERN1/ATF6 pathway (PubMed:19855386, PubMed:21159964). Expression is suppressed by TLR-TRIF signaling pathway during prolonged ER stress (PubMed:16670335, PubMed:19752026, PubMed:19855386, PubMed:19919955, PubMed:21159964, PubMed:22242125). {ECO:0000269|PubMed:16670335, ECO:0000269|PubMed:19752026, ECO:0000269|PubMed:19855386, ECO:0000269|PubMed:19919955, ECO:0000269|PubMed:21159964, ECO:0000269|PubMed:21285359, ECO:0000269|PubMed:22242125}.
Developmental stage：
Protein families：BZIP family