DFB42_MOUSE Q8BVB5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BVB5
Recommended name:Beta-defensin 42
EC number:
Alternative names:(BD-42) (mBD-42) (Defensin, beta 42)
Cleaved into:
GeneID:619548
Gene names (primary ):Defb42
Gene names (synonym ):Defb44
Gene names (ORF ):
Length:75
Mass:8287
Sequence:MNLRLSCLLFILVTSLPAGRCSIGNKGISFETCTAIEGLCFFGCKLGWVWIAYCNNIMSCCRKDTDFVLPQTKGI
Tissue specificity:Epididymis-specific, with highest levels in the initial segment and distal caput. {ECO:0000269|PubMed:16023745}.
Induction:By androgens. {ECO:0000269|PubMed:16023745}.
Developmental stage:
Protein families:Beta-defensin family