SAA1_MOUSE   P05366


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P05366

Recommended name:Serum amyloid A-1 protein

EC number:

Alternative names:

Cleaved into:

GeneID:20208

Gene names  (primary ):Saa1

Gene names  (synonym ):

Gene names  (ORF ):

Length:122

Mass:13770

Sequence:MKLLTSLVFCSLLLGVCHGGFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY

Tissue specificity:Detected in blood plasma (at protein level). Detected in liver. {ECO:0000269|PubMed:3857624, ECO:0000269|PubMed:9518179}.

Induction:By bacterial lipopolysaccharide. {ECO:0000269|PubMed:3857624}.

Developmental stage:

Protein families:SAA family


   💬 WhatsApp