JKAMP_MOUSE Q8BI36
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BI36
Recommended name：JNK1/MAPK8-associated membrane protein
EC number：
Alternative names：(JKAMP) (JNK1-associated membrane protein) (JAMP) (Medulloblastoma antigen MU-MB-50.4 homolog)
Cleaved into：
GeneID：104771
Gene names (primary )：Jkamp
Gene names (synonym )：Jamp
Gene names (ORF )：
Length：311
Mass：35248
Sequence：MAVDIQPACLGLYCGKTLLFKNGSSEIYGECGVCPRGQRTNAQKYCQPCTESPELYDWLYLGFMAMLPLVLHWFFIEWYSGKKSSSALFQHITALFECTMAAIITLLVSDPVGVLYIRSCRVLMLSDWYTMLYNPSPDYVTTVHCTHEAVYPLYTIVFVYYAFCLVLMMLLRPLLVKKIACGLGKSDRFKSIYAALYFFPILTVLQAVGGGLLYYAFPYIILVLSLVTLAVYMSASEIENCYDLLVRKKRLIVLFSHWLLHAYGIVSISRVDRLEHDLPLLALVPTPALFYLFTAKFTEPSRILSEGANGH
Tissue specificity：Expressed in numerous tissues, including brain, spleen, thymus, liver, kidney and testis. Elevated expression in medulloblastoma. {ECO:0000269|PubMed:16166642}.
Induction：By ER stress. {ECO:0000269|PubMed:18784250}.
Developmental stage：
Protein families：